Invitrogen

PAR2 Polyclonal Antibody

View all (17) PAR2 antibodies

Promotion

View available promotion(s)

Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Product Details

PA5-144087

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-
Product Specifications

Species Reactivity

Human

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human PAR2 (349-383aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_3075301

Product Specific Information

Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

Immunogen sequence is different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.

Positive Control - WB: HELA whole cell, COLO320 whole cell, SW620 whole cell, HEPG2 whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

Coagulation factor II (thrombin) receptor-like 1 (F2RL1) is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. The predicted protein sequence is 83% identical to the mouse receptor sequence.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: coagulation factor II (thrombin) receptor-like 1; Coagulation factor II receptor-like 1; G-protein coupled receptor 11; PAR-2; protease-activated receptor 2; Proteinase-activated receptor 2; Thrombin receptor-like 1

View more View less

Gene Aliases: F2RL1; GPR11; PAR2

View more View less

UniProt ID: (Human) P55085

View more View less

Entrez Gene ID: (Human) 2150

View more View less

Function(s)
G-protein alpha-subunit binding receptor activity G-protein coupled receptor activity receptor binding protein binding thrombin receptor activity G-protein beta-subunit binding
Process(es)
T cell activation involved in immune response positive regulation of leukocyte chemotaxis positive regulation of cytokine secretion involved in immune response positive regulation of glomerular filtration inflammatory response G-protein coupled receptor signaling pathway positive regulation of cytosolic calcium ion concentration blood coagulation negative regulation of tumor necrosis factor-mediated signaling pathway positive regulation of phosphatidylinositol 3-kinase signaling regulation of blood coagulation positive regulation of cell migration positive regulation of actin filament depolymerization positive regulation of pseudopodium assembly positive regulation of superoxide anion generation positive regulation of toll-like receptor 2 signaling pathway negative regulation of toll-like receptor 3 signaling pathway positive regulation of toll-like receptor 3 signaling pathway positive regulation of toll-like receptor 4 signaling pathway positive regulation of Rho protein signal transduction chemokine (C-C motif) ligand 2 secretion neutrophil activation regulation of I-kappaB kinase/NF-kappaB signaling positive regulation of I-kappaB kinase/NF-kappaB signaling positive regulation of eosinophil degranulation innate immune response positive regulation of vasodilation positive regulation of transcription from RNA polymerase II promoter regulation of JNK cascade negative regulation of JNK cascade positive regulation of JNK cascade interleukin-1 beta secretion leukocyte migration positive regulation of chemotaxis positive regulation of positive chemotaxis defense response to virus positive regulation of phagocytosis, engulfment establishment of endothelial barrier positive regulation of ERK1 and ERK2 cascade thrombin receptor signaling pathway leukocyte proliferation positive regulation of neutrophil mediated killing of gram-negative bacterium interleukin-10 secretion interferon-gamma secretion chemokine secretion negative regulation of chemokine secretion mature conventional dendritic cell differentiation positive regulation of renin secretion into blood stream positive regulation of interleukin-8 secretion positive regulation of interleukin-6 secretion
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support