Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
PCDH15 Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 11
PCDH15 Antibody (PA5-95603) in IHC (P)
Immunohistochemistry analysis of PCDH15 in paraffin-embedded human prostatic cancer tissues. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with PCDH15 polyclonal antibody (Product # PA5-95603) at a 1 µg/mL dilution, followed by biotinylated goat anti-rabbit IgG (30 min, 37°C), and developed with Strepavidin-Biotin-Co... View More
Product Details
PA5-95603
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human PCDH15 (DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807405
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human placenta tissue, human U2OS whole cell, human Hela whole cell, rat brain tissue, rat lung tissue, mouse brain tissue, mouse lung tissue, mouse kidney tissue, mouse spleen tissue, mouse Neuro-2a whole cell. IHC: human skeletal muscle tissue, human prostatic cancer tissue, human rectal cancer tissue, human tonsil tissue, mouse brain tissue, mouse spleen tissue, rat brain tissue, rat spleen tissue. Flow: U-87MG cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
PCDH15 is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. PCDH15 consists of a signal peptide, 11 extracellular calcium-binding domains, a transmembrane domain and a unique cytoplasmic domain. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene have been associated with hearing loss, which is consistent with its location at the Usher syndrome type 1F (USH1F) critical region on chromosome 10.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Ames waltzer; cadherin-related family member 15; DKFZp667A1711; protocadherin 15 CD2; protocadherin 15 CD3 isoform; Protocadherin-15; protocadherin-related 15; RP11-449J3.2
Gene Aliases: av; BB078305; CDHR15; DFNB23; ENSMUSG00000046980; Gm9815; nmf19; PCDH15; USH1F
UniProt ID: (Human) Q96QU1, (Mouse) Q99PJ1
Entrez Gene ID: (Human) 65217, (Rat) 690865, (Mouse) 11994
homophilic cell adhesion via plasma membrane adhesion molecules
sensory perception of sound
photoreceptor cell maintenance
inner ear development
sensory perception of light stimulus
equilibrioception
startle response
morphogenesis of an epithelium
actin filament organization
visual perception
locomotory behavior
adult walking behavior
adult locomotory behavior
nonmotile primary cilium assembly
multicellular organism growth
auditory receptor cell differentiation
detection of mechanical stimulus involved in sensory perception of sound
detection of mechanical stimulus involved in equilibrioception
response to calcium ion
righting reflex
auditory receptor cell stereocilium organization
cell adhesion
inner ear receptor stereocilium organization
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support