Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
PDK4 Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 1
PDK4 Antibody (PA5-79800) in WB
Western blot analysis of PDK4 in, Lane 1: human HepG2 whole cell lysates, Lane 2: human Hela whole cell lysates, Lane 3: human A549 whole cell lysates, Lane 4: rat skeletal muscle tissue lysates, Lane 5: rat heart tissue lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. After Electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. The mem... View More
Product Details
PA5-79800
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human PDK4 (91-125aa WYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRN).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746915
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human HepG2 whole cell, human Hela whole cell, human A549 whole cell, rat skeletal muscle tissue, rat heart tissue.
Target Information
PDK4 (PDHK4), along with the other PDHKs, regulates glucose metabolism by phosphorylating the E1 alpha subunit of the mitochondrial pyruvate dehydrogenase complex. Inhibition of PDHKs is viewed as a potential therapeutic treatment for type II diabetes. This protein is located in the matrix of the mitrochondria and it's expression is regulated by glucocorticoids, retinoic acid and insulin. PDK4 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial; [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial; kinase isozyme 4; lipoamide; pyruvate dehydrogenase; Pyruvate dehydrogenase kinase isoform 4; pyruvate dehydrogenase kinase, isoenzyme 4; pyruvate dehydrogenase kinase, isozyme 4; pyruvate dehydrogenase, lipoamide, kinase isozyme 4, mitochondrial; pyruvate dehydrogenate kinase 4
Gene Aliases: PDHK4; PDK4
UniProt ID: (Human) Q16654, (Rat) O54937
Entrez Gene ID: (Human) 5166, (Rat) 89813
positive regulation of defense response to virus by host
glucose metabolic process
protein phosphorylation
regulation of pH
insulin receptor signaling pathway
cellular response to starvation
regulation of acetyl-CoA biosynthetic process from pyruvate
regulation of cellular ketone metabolic process
regulation of glucose metabolic process
regulation of fatty acid biosynthetic process
glucose homeostasis
response to starvation
regulation of bone resorption
regulation of fatty acid oxidation
cellular response to fatty acid
reactive oxygen species metabolic process
xenophagy
negative regulation of anoikis
acetyl-CoA biosynthetic process from pyruvate
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support