Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Pokemon Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 3
Pokemon Antibody (PA5-80246) in IHC (P)
Immunohistochemistry analysis of Pokemon on paraffin-embedded mouse intestine tissue. Sample was incubated with Pokemon polyclonal antibody (Product# PA5-80246) with a dilution of 1 µg/mL, and developed by Streptavidin-Biotin-Complex (SABC) with DAB chromogen method.
Product Details
PA5-80246
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of mouse ZBTB7A (125-163aa DLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2747360
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: mouse kidney tissue, NIH/3T3 whole cell. IHC: mouse intestine tissue, rat brain tissue.
Target Information
Plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals. Specifically represses the transcription of the CDKN2A gene. Efficiently abrogates E2F1-dependent CDKN2A transactivation/de-repression. Binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: DKFZp547O146; leukemia/lymphoma related factor; Leukemia/lymphoma-related factor; MGC99631; Osteoclast-derived zinc finger protein; POK erythroid myeloid ontogenic factor; POZ and Krueppel erythroid myeloid ontogenic factor; zi; Zinc finger and BTB domain-containing protein 7A
Gene Aliases: 9030619K07Rik; 9130006G12Rik; AI452336; FBI-1; Lrf; OCZF; Pokemon; Zbtb7; Zbtb7a
UniProt ID: (Mouse) O88939, (Rat) Q9QZ48
Entrez Gene ID: (Mouse) 16969, (Rat) 117107
RNA polymerase II core promoter proximal region sequence-specific DNA binding
transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
nucleic acid binding
DNA binding
transcription factor activity, sequence-specific DNA binding
protein binding
histone acetyltransferase binding
metal ion binding
negative regulation of transcription from RNA polymerase II promoter
transcription, DNA-templated
regulation of transcription, DNA-templated
transcription from RNA polymerase II promoter
multicellular organism development
cell differentiation
regulation of osteoclast differentiation
negative regulation of transcription, DNA-templated
cartilage development
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support