Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
RAB14 Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 1
RAB14 Antibody (PA5-79903) in WB
Western blot analysis of RAB14 using RAB14 Polyclonal Antibody (Product # PA5-79903). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. Lane 1: Rat Brain Tissue Lysate at 50 µg. Lane 2: RAJI Whole Cell Lysate at 40 µg. Lane 3: SMMC Whole Cell Lysate at 40 µg. After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with RAB14 Polyclonal An... View More
Product Details
PA5-79903
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human RAB14 (124-153aa NKADLEAQRDVTYEEAKQFAEENGLLFLEA).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2747018
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Rat Brain Tissue, RAJI whole cell, SMMC whole cell.
Target Information
Localized to biosynthetic and endosomal compartments, Rab14 is involved in the biosynthetic/recycling pathway between the Golgi and endosomal compartments.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: bA165P4.3 (member RAS oncogene family); F protein-binding protein 1; GTPase Rab14; Ras-related protein Rab-14; small GTP binding protein RAB14
Gene Aliases: FBP; RAB-14; RAB14
UniProt ID: (Human) P61106, (Rat) P61107
Entrez Gene ID: (Human) 51552, (Rat) 94197
intracellular protein transport
Golgi to endosome transport
small GTPase mediated signal transduction
body fluid secretion
metabolic process
fibroblast growth factor receptor signaling pathway
protein transport
vesicle-mediated transport
endocytic recycling
Rab protein signal transduction
regulation of protein localization
apical protein localization
intracellular transport
phagolysosome assembly involved in apoptotic cell clearance
embryo development
defense response to bacterium
membrane organization
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support