Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
RAB18 Antibody (PA5-95323) in WB
Western blot analysis of RAB18 in Lane 1: rat testis tissue lysate (50 µg), Lane 2: rat lung tissue lysate (50 µg), Lane 3: 293T whole cell lysate (40 µg), Lane 4: HeLa whole cell lysate (40 µg), Lane 5: HEPG2 whole cell lysate (40 µg). Samples were incubated with RAB18 polyclonal antibody (Product # PA5-95323).
Product Details
PA5-95323
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Rab18 (156-192aa DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807126
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Rat Testis Tissue, Rat Lung Tissue, 293T whole cell, HELA whole cell, HEPG2 whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies is zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: RAB18 small GTPase; Ras-related protein Rab-18
Gene Aliases: RAB18; RAB18LI1; WARBM3
UniProt ID: (Human) Q9NP72, (Rat) Q5EB77
Entrez Gene ID: (Human) 22931, (Rat) 307039
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support