Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
RPA70 Monoclonal Antibody (11H4)
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 6
RPA70 Antibody (MA5-36226) in ICC/IF
Immunocytochemistry analysis of RPA70 in A549 cells. Antigen retrieval was performed with enzyme antigen retrieval (15 min). Samples were blocked with 10% goat serum and incubated in RPA70 monoclonal antibody (Product # MA5-36226) at a dilution of 2 µg/mL (overnight, 4°C), followed by Dylight 488 conjugated goat anti-mouse IgG (30 min, 37°C) and DAPI at a dilution of 5-10 µg/1x10^6 cells (30 min, 20°C).
Product Details
MA5-36226
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Non-human primate
Host/Isotype
Mouse
/ IgG2b
Class
Monoclonal
Type
Antibody
Clone
11H4
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2884060
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: HELA whole cell, MCF-7 whole cell, K562 whole cell, COS-7 whole cell, Caco-2 whole cell, A549 whole cell, HEPG2 whole cell, PC-3 whole cell, HEPA1-6 whole cell. IHC: human intestinal cancer tissue, human lung cancer tissue, human lung cancer tissue. ICC/IF: A549 cell. Flow: A431 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
This gene Plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair. Binds and subsequently stabilizes single-stranded DNA intermediates and thus prevents complementary DNA from reannealing.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: MSTP075; Replication factor A protein 1; Replication protein A 70 kDa DNA-binding subunit; replication protein A1, 70kDa; RF-A protein 1; RP-A p70; Single-stranded DNA-binding protein
Gene Aliases: 5031405K23Rik; 70kDa; AA589576; AW557552; HSSB; MST075; REPA1; RF-A; RP-A; Rpa; RPA1; RPA70
UniProt ID: (Human) P27694, (Mouse) Q8VEE4
Entrez Gene ID: (Human) 6117, (Mouse) 68275
G1/S transition of mitotic cell cycle
telomere maintenance via recombination
telomere maintenance
double-strand break repair via homologous recombination
DNA replication
DNA-dependent DNA replication
DNA repair
transcription-coupled nucleotide-excision repair
base-excision repair
nucleotide-excision repair
nucleotide-excision repair, preincision complex stabilization
nucleotide-excision repair, preincision complex assembly
nucleotide-excision repair, DNA incision, 3'-to lesion
nucleotide-excision repair, DNA incision, 5'-to lesion
nucleotide-excision repair, DNA gap filling
mismatch repair
DNA recombination
protein sumoylation
translesion synthesis
nucleotide-excision repair, DNA incision
interstrand cross-link repair
error-prone translesion synthesis
DNA damage response, detection of DNA damage
error-free translesion synthesis
regulation of cellular response to heat
regulation of signal transduction by p53 class mediator
cell cycle checkpoint
in utero embryonic development
cellular response to DNA damage stimulus
meiotic nuclear division
positive regulation of cell proliferation
hemopoiesis
homeostasis of number of cells within a tissue
chromosome organization
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support