Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • SERCA2 ATPase Antibodies

          Invitrogen

          SERCA2 ATPase Polyclonal Antibody

          Advanced Verification
          1 Reference
          View all (21) SERCA2 ATPase antibodies

          Promotion

          View available promotion(s)

          Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite SERCA2 ATPase Polyclonal Antibody

          • Antibody Testing Data (6)
          • Advanced Verification (1)
          SERCA2 ATPase Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          SERCA2 ATPase Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 7

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          SERCA2 ATPase Antibody (PA5-78837) in ICC/IF

          Immunofluorescence analysis of SERCA2 was performed using 70% confluent log phase A549 cells. The cells were fixed with 4% paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton™ X-100 for 15 minutes, and blocked with 2% BSA for 1 hour at room temperature. The cells were labeled with SERCA2 ATPase Polyclonal Antibody (Product # PA5-78837) at 1:100 dilution in 0.1% BSA, incubated at 4 degree Celsius... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          SERCA2 ATPase Antibody in Immunocytochemistry (ICC/IF)
          SERCA2 ATPase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SERCA2 ATPase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SERCA2 ATPase Antibody in Western Blot (WB)
          SERCA2 ATPase Antibody in Western Blot (WB)
          SERCA2 ATPase Antibody in Western Blot (WB)
          SERCA2 ATPase Antibody

          Product Details

          PA5-78837

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          1:100
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA2 ATPase (1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745953

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat heart tissue, mouse heart tissue. IHC: Mouse Lung tissue, Rat Lung tissue.

          Target Information

          This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in multiple transcript variants encoding different isoforms.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: ATPase Ca++ transporting cardiac muscle slow twitch 2; ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2; ATPase, Ca++ transporting, slow twitch 2; Calcium pump 2; Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform; cardiac Ca2+ ATPase; Endoplasmic reticulum class 1/2 Ca(2+) ATPase; sarco(endo)plasmic reticulum Ca(2+)-dependent ATPase 2; sarco/endoplasmic reticulum Ca2+-ATPase 2; Sarcoplasmic/endoplasmic reticulum calcium ATPase 2; SERCA; SERCA ATPase; SERCA2; SR Ca(2+)-ATPase 2

          View more View less

          Gene Aliases: 9530097L16Rik; ATP2A2; ATP2B; D5Wsu150e; DAR; DD; mKIAA4195; SERCA2; Serca2a; SERCA2B; SercaII

          View more View less

          UniProt ID: (Human) P16615, (Mouse) O55143, (Rat) P11507

          View more View less

          Entrez Gene ID: (Human) 488, (Mouse) 11938, (Rat) 29693

          View more View less

          Function(s)
          calcium-transporting ATPase activity calcium ion binding protein binding ATP binding protein C-terminus binding enzyme binding lutropin-choriogonadotropic hormone receptor binding S100 protein binding calcium-transporting ATPase activity involved in regulation of cardiac muscle cell membrane potential nucleotide binding hydrolase activity metal ion binding
          Process(es)
          regulation of the force of heart contraction ER-nucleus signaling pathway organelle organization cell adhesion epidermis development positive regulation of heart rate regulation of cardiac muscle contraction by calcium ion signaling transition between fast and slow fiber endoplasmic reticulum calcium ion homeostasis positive regulation of endoplasmic reticulum calcium ion concentration T-tubule organization ion transmembrane transport cellular response to oxidative stress response to endoplasmic reticulum stress response to peptide hormone negative regulation of heart contraction relaxation of cardiac muscle sarcoplasmic reticulum calcium ion transport calcium ion transmembrane transport regulation of cardiac muscle cell membrane potential regulation of cardiac muscle cell action potential involved in regulation of contraction regulation of calcium ion-dependent exocytosis of neurotransmitter calcium ion transport from cytosol to endoplasmic reticulum regulation of cardiac conduction calcium ion import into sarcoplasmic reticulum transport ion transport calcium ion transport cellular calcium ion homeostasis regulation of muscle contraction metabolic process
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-67c77f6dc7-n6nf2:80/100.66.135.186:80.
          git-commit: 545e792480003146e539d624bd2a21b51d198228
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.31.0-2025.06.23-1.0