Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • SFTPA1/SFTPA2 Antibodies

          Invitrogen

          SFTPA1/SFTPA2 Polyclonal Antibody

          1 Reference
          View all (2) SFTPA1/SFTPA2 antibodies

          Promotion

          View available promotion(s)

          Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite SFTPA1/SFTPA2 Polyclonal Antibody

          • Antibody Testing Data (8)
          SFTPA1/SFTPA2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          SFTPA1/SFTPA2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 8

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          SFTPA1/SFTPA2 Antibody (PA5-79987) in IHC (P)

          Immunohistochemistry (Paraffin) analysis of SFTPA1/SFTPA2 in paraffin-embedded section of rat lung tissue using SFTPA1/SFTPA2 Polyclonal Antibody (Product # PA5-79987). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 5 µg/mL dilution over... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          SFTPA1/SFTPA2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SFTPA1/SFTPA2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SFTPA1/SFTPA2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SFTPA1/SFTPA2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SFTPA1/SFTPA2 Antibody in Immunohistochemistry (Frozen) (IHC (F))
          SFTPA1/SFTPA2 Antibody in Immunohistochemistry (Frozen) (IHC (F))
          SFTPA1/SFTPA2 Antibody in Western Blot (WB)
          SFTPA1/SFTPA2 Antibody in Western Blot (WB)

          Product Details

          PA5-79987

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunohistochemistry (Frozen) (IHC (F))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2 (206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2747102

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat lung tissue, mouse lung tissue. IHC: Mouse Lung tissue, Rat Lung tissue, Human Lung Cancer tissue IHC-F: Mouse Lung tissue, Rat Lung tissue.

          Target Information

          Surfactant protein A (SP-A) is synthesized and secreted by lung epithelial cells. It belongs to group III of the family of C-type lectins and members of this group has overall structure consisting of multiple globular 'head' regions linked by triple-helical, collagen-like, strands. This group also includes SP-D and the serum proteins mannan-binding protein, conglutinin and collectin-43, all of which have been shown to bind to the C1q receptor found on a wide variety of cells. Both SP-D and SP-A have been shown to enhance oxygen radical production by alveolar macrophages. The serum concentration is 45 ng/mL in healthy individuals.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: 35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; collectin 5; Collectin-4; Collectin-5; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590; PSAP; PSP-A; Pulmonary surfactant-associated protein A; Pulmonary surfactant-associated protein A1; Pulmonary surfactant-associated protein A2; SP-2A beta; SP-2A gamma; SP-A1 beta; SP-A1 delta; SP-A1 epsilon; SP-A1 gamma; SP-A2; SP-A2 alpha; SP-A2 delta; surfactant associated protein A; surfactant protein A1 variant AB'D' 6A; surfactant protein A1 variant AB'D' 6A2; surfactant protein A1 variant AB'D' 6A3; surfactant protein A1 variant AB'D' 6A4; surfactant protein A1 variant ACD' 6A; surfactant protein A1 variant ACD' 6A2; surfactant protein A1 variant ACD' 6A3; surfactant protein A1 variant ACD' 6A4; surfactant protein A1 variant AD' 6A; surfactant protein A1 variant AD' 6A2; surfactant protein A1 variant AD' 6A3; surfactant protein A1 variant AD' 6A4; surfactant protein A1B; surfactant pulmonary associated protein A1; surfactant, pulmonary-associated protein A1; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; surfactant, pulmonary-associated protein A2A; Surfactant-associated protein 1 (pulmonary surfactant protein SP-A); Surfactant-associated protein 1 (pulmonary surfactant protein, SP-A)

          View more View less

          Gene Aliases: COLEC4; COLEC5; PSAP; PSP-A; PSPA; Sftp-1; SFTP1; SFTPA; SFTPA1; SFTPA1B; SFTPA2; SFTPA2B; Sftpl; SP-2A; SP-A; SP-A1; SPA; SPA1; SPA2; SPAII

          View more View less

          UniProt ID: (Human) Q8IWL2, (Human) Q8IWL1, (Rat) P08427

          View more View less

          Entrez Gene ID: (Human) 653509, (Human) 729238, (Rat) 24773, (Mouse) 20387

          View more View less

          Function(s)
          lipid transporter activity protein binding carbohydrate binding metal ion binding
          Process(es)
          lipid transport respiratory gaseous exchange cellular protein metabolic process response to hypoxia circadian rhythm response to hormone response to lipopolysaccharide response to retinoic acid response to vitamin A positive regulation of phagocytosis response to glucocorticoid response to hyperoxia response to interleukin-6 response to epidermal growth factor cellular response to mechanical stimulus cellular response to nitric oxide
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-5d94444789-48zfn:80/100.66.135.186:80.
          git-commit: ec3573d8beaf0fd412f2d0ea2dcb8dd14c74098c
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.31.0-2025.06.23-1.0