Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 5
SKA2 Antibody (PA5-114386) in WB
Western blot analysis of SKA2 in the following samples: Lane 1: human A431 whole cell lysates, Lane 2: human U2OS whole cell lysates, Lane 3: human PC-3 whole cell lysates, Lane 4: human HEK293 whole cell lysates, Lane 5: human HL-60 whole cell lysates, Lane 6: human K562 whole cell lysates, Lane 7: human Caco-2 whole cell lysates, Lane 8: human HeLA whole cell lysates. Samples consisting of 50 µg (reducing conditions) of protein was separated with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V, Resolving gel; 2-3 hrs.), transferred to a Nitro... View More
Product Details
PA5-114386
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human SKA2 (EAEVDKLELMFQKAESDLDYIQYRLEYEIK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2884842
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human A431 whole cell, human U2OS whole cell, human PC-3 whole cell, human HEK293 whole cell, human HL-60 whole cell, human K562 whole cell, human Caco-2 whole cell, human Hela whole cell. Flow: 293T cell, U20S cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Upon entry into mitosis, the cell’s microtubule (MT) network forms the mitotic spindle, allowing the segregation of paired chromosomes. Proteinaceous structures on centromeric chromatin termed kinetochores (KT) are essential for the proper attachment of the chromosomes to the spindle MTs. A recently discovered spindle and kinetochore complex, comprised of proteins SKA1, SKA2, and SKA3, has been found to be required for stable KT-MT interactions and timely anaphase onset. Depletion of either SKA1 or SKA2 by siRNA results in the loss of both proteins from the KT, but does not impact overall KT structure. Cells depleted of the SKA complex undergo a prolonged checkpoint-dependent delay in a metaphase-like state, indicating the importance of the SKA complex in the maintenance of the metaphase plate and spindle checkpoint silencing. SKA2 has also been shown to interact with glucocorticoid receptors and to be involved in glucocorticoid signaling and cell proliferation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: family with sequence similarity 33, member A; Protein FAM33A; Spindle and kinetochore-associated protein 2; spindle and KT (kinetochore) associated 2
Gene Aliases: FAM33A; SKA2
UniProt ID: (Human) Q8WVK7
Entrez Gene ID: (Human) 348235
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support