Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 4
ST7 Antibody (PA5-95405) in ICC/IF
Immunocytochemistry/Immunofluorescence analysis of ST7 in A431 cell using ST7 Polyclonal Antibody (Product # PA5-95405). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 5 µg/mL and mouse anti-Beta Tubulin antibody overnight at 4°C. Cy3 conjugated goat anti-rabbit IgG and DyLight 488 conjugated goat anti-mouse IgG were used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize... View More
Product Details
PA5-95405
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ST7 (268-309aa DGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCARRL).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2807208
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human Jurkat whole cell, human PC-3 whole cell, rat brain tissue, rat heart tissue, mouse brain tissue, mouse heart tissue, mouse Neuro-2a whole cell. ICC/IF: A431 cell. Flow: 293T cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 4low density lipoprotein-related protein 12; family with sequence similarity 4, subfamily A, member 1; family with sequence similarity 4, subfamily A, member 2; mRay; Protein FAM4A1; Protein HELG; suppression of tumorigenicity 7 (breast); Suppressor of tumorigenicity 7 protein; suppressor of tumorigenicity protein 7
Gene Aliases: 9430001H04Rik; ETS7q; FAM4A; FAM4A1; Fam4a2; HELG; RAY1; SEN4; ST7; TSG7
UniProt ID: (Human) Q9NRC1, (Rat) Q2IBD0, (Mouse) Q99M96
Entrez Gene ID: (Human) 7982, (Rat) 296911, (Mouse) 64213
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support