Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • STAT1 Antibodies

          Invitrogen

          STAT1 Polyclonal Antibody

          View all (90) STAT1 antibodies

          Promotion

          View available promotion(s)

          Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite STAT1 Polyclonal Antibody

          • Antibody Testing Data (6)
          STAT1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          STAT1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 6

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          STAT1 Antibody (PA5-95267) in IHC (P)

          Immunohistochemistry analysis of STAT1 in paraffin-embedded human mammary cancer tissue. Samples were incubated with STAT1 polyclonal antibody (Product # PA5-95267). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          STAT1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          STAT1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          STAT1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          STAT1 Antibody in Western Blot (WB)
          STAT1 Antibody in Western Blot (WB)
          STAT1 Antibody in Flow Cytometry (Flow)

          Product Details

          PA5-95267

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human STAT1 (114-143aa KILENAQRFNQAQSGNIQSTVMLDKQKELD).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807071

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human MCF-7 whole cell, human SiHa whole cell, human A549 whole cell, rat lung tissue, mouse lung tissue. Flow: A549 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          STAT1 (signal transducers and activators of transcription 1) is a member of the STAT family of transcription factors. STAT1 can be activated by interferon-alpha, interferon-gamma, EGF, PDGF and IL6. STAT1 is known to regulate several genes which are involved in cell growth, apoptosis, immune responses, and lipid metabolism. Further, STAT1 plays an important role in mediating cell viability in response to different cell stimuli and pathogen exposure. The STAT1 gene is located on chromosome 2. STAT1 is activated to regulate gene expression in response to extracellular signaling polypeptides including cytokines, interferons, and growth factors. After phosphorylation by JAK tyrosine kinases, STAT1 enters the nucleus to regulate transcription of many different genes. Among the seven STATs types, STAT1, STAT3, STAT5a, and STAT5b have a wide activation profile. STAT1 is activated by many different ligands including IFN family (IFN-Alpha, IFN-Beta, IFN-gamma and IL-10), gp130 family (IL-6, IL-11, LIF, CNTF, and G-CSF), and receptor tyrosine kinases (EGF, PDGF, and CSF-1). Two alternatively spliced transcript variants encoding distinct isoforms of STAT1 have been described.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: DKFZp686B04100; OTTHUMP00000165046; OTTHUMP00000205845; signal transducer and activator of transcription 1; signal transducer and activator of transcription 1, 91kD; signal transducer and activator of transcription 1, 91kDa; Signal transducer and activator of transcription 1-alpha/beta; signal transducer and activator of transcription-1; STAT; STAT 1; STAT-1; stat1 alpha; Transcription factor ISGF-3 components p91/p84

          View more View less

          Gene Aliases: 2010005J02Rik; AA408197; CANDF7; DD6G4-4; IMD31A; IMD31B; IMD31C; ISGF-3; STAT1; STAT91

          View more View less

          UniProt ID: (Human) P42224

          View more View less

          Entrez Gene ID: (Human) 6772, (Mouse) 20846, (Rat) 25124

          View more View less

          Function(s)
          RNA polymerase II core promoter proximal region sequence-specific DNA binding RNA polymerase II core promoter sequence-specific DNA binding transcription factor activity, RNA polymerase II core promoter sequence-specific double-stranded DNA binding transcription factor activity, sequence-specific DNA binding signal transducer activity tumor necrosis factor receptor binding protein binding enzyme binding nuclear hormone receptor binding identical protein binding protein homodimerization activity cadherin binding involved in cell-cell adhesion DNA binding CCR5 chemokine receptor binding sequence-specific DNA binding protein phosphatase 2A binding
          Process(es)
          negative regulation of endothelial cell proliferation transcription, DNA-templated regulation of transcription, DNA-templated transcription from RNA polymerase II promoter activation of cysteine-type endopeptidase activity involved in apoptotic process signal transduction JAK-STAT cascade response to nutrient blood circulation positive regulation of cell proliferation response to mechanical stimulus response to bacterium negative regulation of angiogenesis cytokine-mediated signaling pathway lipopolysaccharide-mediated signaling pathway response to lipopolysaccharide cellular response to insulin stimulus tumor necrosis factor-mediated signaling pathway response to cytokine negative regulation of macrophage fusion cellular response to interferon-beta response to drug negative regulation of I-kappaB kinase/NF-kappaB signaling response to exogenous dsRNA response to peptide hormone positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter negative regulation by virus of viral protein levels in host cell positive regulation of smooth muscle cell proliferation response to cAMP interferon-gamma-mediated signaling pathway type I interferon signaling pathway renal tubule development cellular response to lipopolysaccharide regulation of transcription from RNA polymerase II promoter response to organic cyclic compound response to hydrogen peroxide endothelial cell migration negative regulation of transcription from RNA polymerase II promoter positive regulation of mesenchymal cell proliferation negative regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis apoptotic process macrophage derived foam cell differentiation response to interferon-beta regulation of apoptotic process defense response to virus regulation of interferon-gamma-mediated signaling pathway regulation of type I interferon-mediated signaling pathway cellular response to organic cyclic compound metanephric mesenchymal cell proliferation involved in metanephros development metanephric mesenchymal cell differentiation negative regulation of metanephric nephron tubule epithelial cell differentiation cell-cell adhesion
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-67c77f6dc7-n6nf2:80/100.66.135.186:80.
          git-commit: 545e792480003146e539d624bd2a21b51d198228
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.31.0-2025.06.23-1.0