Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
SUR1 Antibody (PA5-78697) in Flow
Flow Cytometry of SUR1 in A431 cells (blue line), isotype control rabbit IgG (green line) and unlabeled (red line). Samples were blocked with 10% goat serum and then incubated with SUR1 Polyclonal Antibody, DyLight™ 488 (Product # PA5-78697) at a dilution of 1 μg (per 1x10^6 cells) for 30 min at 20°C.
Product Details
PA5-78697
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA).
Conjugate
Excitation/Emission Max
492/519 nm
View spectra
Form
Liquid
Concentration
0.5 mg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 50% glycerol
Contains
0.02% sodium azide
Storage conditions
4°C, store in dark, DO NOT FREEZE!
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2745813
Product Specific Information
Positive Control - Flow: A431 cell.
Target Information
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies. This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternative splicing of this gene has been observed; however, the transcript variants have not been fully described.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
How to use the Panel Builder
Watch the video to learn how to use the Invitrogen Flow Cytometry Panel Builder to build your next flow cytometry panel in 5 easy steps.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: AM60008PU-N; ATP-binding cassette sub-family C member 8; ATP-binding cassette transporter sub-family C member 8; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; PH SUR1; sulfonylurea receptor (hyperinsulinemia); Sulfonylurea receptor 1
Gene Aliases: ABC36; ABCC8; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
UniProt ID: (Human) Q09428
Entrez Gene ID: (Human) 6833
potassium ion transport
signal transduction
response to pH
response to zinc ion
response to lipopolysaccharide
response to insulin
response to drug
positive regulation of potassium ion transport
negative regulation of insulin secretion
regulation of insulin secretion
transmembrane transport
cellular response to organic substance
potassium ion transmembrane transport
anion transmembrane transport
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support