Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • Tyrosine Hydroxylase Antibodies

          Invitrogen

          Tyrosine Hydroxylase Polyclonal Antibody

          Advanced Verification
          View all (65) Tyrosine Hydroxylase antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite Tyrosine Hydroxylase Polyclonal Antibody

          • Antibody Testing Data (7)
          • Advanced Verification (2)
          Tyrosine Hydroxylase Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          Tyrosine Hydroxylase Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 9

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Tyrosine Hydroxylase Antibody (PA5-80120) in ICC/IF

          Immunofluorescence analysis of Tyrosine Hydroxylase using Anti-Tyrosine Hydroxylase Polyclonal Antibody (Product # PA5-80120) was performed using 70% confluent log phase PC-12 cells treated with 1 µg/mL dexamethasone for 6 days. The cells were fixed with 4% Paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton™ X-100 for 10 minutes, and blocked with 2% BSA for 10 minutes at room temperature. The c... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Tyrosine Hydroxylase Antibody in Immunocytochemistry (ICC/IF)
          Tyrosine Hydroxylase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Tyrosine Hydroxylase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Tyrosine Hydroxylase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Tyrosine Hydroxylase Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Tyrosine Hydroxylase Antibody in Western Blot (WB)
          Tyrosine Hydroxylase Antibody in Western Blot (WB)
          Tyrosine Hydroxylase Antibody
          Tyrosine Hydroxylase Antibody

          Product Details

          PA5-80120

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2747235

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat brain tissue, mouse brain tissue. IHC: mouse brain tissue, rat brain tissue.

          Target Information

          Tyrosine hydroxylase (TH) is an enzyme involved in the synthesis of catecholamine neurotransmitters dopamine, epinephrine, and norepinephrine. In all species, catecholamine synthesis is regulated by the interaction of TH with a cofactor, tetrahydrobiopterin (BH4). BH4 binds to the TH catalytic domain, resulting in enzymatic activity. Unlike TH in non-primate species, four human TH mRNA splice variants (hTH1-hTH4) have been isolated. These variants are identical in their catalytic domain, but differ in their N-terminal, regulatory domains. TH is also responsible for the conversion of L-tyrosine to L-dopa. TH plays a key role in the physiology of adrenergic neurons. The role of TH in the synthesis of catecholamine neurotransmitters suggests a correlation between the enzyme and a number of neuropathogenic diseases including: Parkinson's disease, schizophrenia, Segawa syndrome, and dystonia, as well as a variety of cardiovascular diseases.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: dystonia 14; EC 1.14.16.2; HGNC:11782; TH; TH isoform 3; TH isoform a; TH-4; TY3H; TYH antibody; Tyrosine 3-hydroxylase; Tyrosine 3-monooxygenase

          View more View less

          Gene Aliases: DYT14; DYT5b; TH; The; TYH

          View more View less

          UniProt ID: (Human) P07101, (Mouse) P24529, (Rat) P04177

          View more View less

          Entrez Gene ID: (Human) 7054, (Mouse) 21823, (Rat) 25085

          View more View less

          Function(s)
          tyrosine 3-monooxygenase activity protein binding ferrous iron binding ferric iron binding amino acid binding oxygen binding enzyme binding protein domain specific binding tetrahydrobiopterin binding dopamine binding monooxygenase activity iron ion binding oxidoreductase activity oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen metal ion binding
          Process(es)
          response to hypoxia synaptic transmission, dopaminergic dopamine biosynthetic process from tyrosine heart development visual perception learning memory mating behavior locomotory behavior regulation of heart contraction aromatic amino acid family metabolic process organ morphogenesis aminergic neurotransmitter loading into synaptic vesicle neurotransmitter biosynthetic process dopamine biosynthetic process epinephrine biosynthetic process norepinephrine biosynthetic process catecholamine biosynthetic process eye photoreceptor cell development eating behavior response to ethanol embryonic camera-type eye morphogenesis oxidation-reduction process response to amphetamine heart morphogenesis fatty acid metabolic process sphingolipid metabolic process sensory perception of sound response to water deprivation response to light stimulus response to herbicide response to salt stress anatomical structure morphogenesis response to zinc ion multicellular organism aging response to activity glycoside metabolic process phthalate metabolic process cerebral cortex development response to nutrient levels response to estradiol response to lipopolysaccharide isoquinoline alkaloid metabolic process social behavior cellular response to drug response to isolation stress response to immobilization stress terpene metabolic process circadian sleep/wake cycle response to peptide hormone pigmentation response to ether response to pyrethroid response to corticosterone response to electrical stimulus phytoalexin metabolic process cellular response to manganese ion cellular response to nicotine cellular response to glucose stimulus cellular response to growth factor stimulus response to metal ion response to organic cyclic compound response to insecticide response to nicotine response to drug response to steroid hormone cognition protein homotetramerization response to growth factor cellular response to alkaloid
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-845544bffd-zxsgg:80/100.66.135.11:80.
          git-commit: 2bb44be0f35b85de1c1d8e4f377b85e7a3a71488
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.32.0-2025.07.28-1.0