Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
UBE1 Antibody (PA5-95346) in WB
Western blot analysis of UBE1 in rat liver extract (lane 1), mouse liver extract (lane 2), mouse testis extract (lane 3) and HeLa whole cell lysates (lane 4). Samples were incubated with UBE1 polyclonal antibody (Product # PA5-95346) using a 0.5 µg/mL dilution. developed was performed using enhanced chemiluminescence (ECL).
Product Details
PA5-95346
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human UBA1 (102-139aa HDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELN).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807149
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat liver tissue, mouse liver tissuemouse testis tissueHELA whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
UBE1 catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11. 23. Alternative splicing results in 2 transcript variants encoding the same protein, but with different 5' UTR.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: A1S9 protein; A1S9T and BN75 temperature sensitivity complementing; POC20 centriolar protein homolog; Protein A1S9; testicular secretory protein Li 63; uba1 {ECO:0000312|EMBL:AAH85791.1, ECO:0000312|RGD:1359327}; UBA1, ubiquitin-activating enzyme E1 homolog A; Ubiquitin-activating enzyme E1; Ubiquitin-activating enzyme E1 X; ubiquitin-activating enzyme E1 {ECO:0000250|UniProtKB:Q02053}; ubiquitin-activating enzyme E1, Chr X; ubiquitin-like modifier activating enzyme 1; Ubiquitin-like modifier-activating enzyme 1; Ubiquitin-like modifier-activating enzyme 1 X; ubiquitin-like modifier-activating enzyme 1 {ECO:0000250|UniProtKB:Q02053}
Gene Aliases: A1S9; A1S9T; A1ST; AMCX1; CFAP124; GXP1; POC20; Sbx; SMAX2; UBA1; UBA1A; Ube-1; UBE1; Ube1ax; UBE1X
UniProt ID: (Human) P22314, (Mouse) Q02053, (Rat) Q5U300
Entrez Gene ID: (Human) 7317, (Mouse) 22201, (Rat) 314432
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support