Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
UHRF2 Monoclonal Antibody (6B5)
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 6
UHRF2 Antibody (MA5-49293) in ICC/IF
Immunocytochemistry analysis of UHRF2 in Hela cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. Samples were then incubated in UHRF2 Monoclonal antibody (Product # MA5-49293) using a dilution of 5 μg/mL. DyLight®488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for... View More
Product Details
MA5-49293
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Mouse
/ IgG2b
Class
Monoclonal
Type
Antibody
Clone
6B5
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15-54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_3074951
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Immunogen sequence is identical to the related mouse and rat sequences.
Positive Control - WB: human HepG2 whole cell, human HT1080 whole cell, human Jurkat whole cell. ICC/IF: Hela cell. Flow: Hela cell, RH35 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: E3 ubiquitin-protein ligase UHRF2; Np95-like RING finger protein; Np95/ICBP90-like RING finger protein; Nuclear protein 97; Nuclear zinc finger protein Np97; RING finger protein 107; RING-type E3 ubiquitin transferase UHRF2; RP11-472F14.2; Ubiquitin-like PHD and RING finger domain-containing protein 2; ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase; ubiquitin-like, containing PHD and RING finger domains 2; ubiquitin-like, containing PHD and RING finger domains, 2; Ubiquitin-like-containing PHD and RING finger domains protein 2
Gene Aliases: NIRF; RNF107; TDRD23; UHRF2; URF2
UniProt ID: (Human) Q96PU4
Entrez Gene ID: (Human) 115426, (Rat) 309331
cell cycle
cell proliferation
maintenance of DNA methylation
protein ubiquitination
cell differentiation
regulation of cell cycle
protein autoubiquitination
positive regulation of cell cycle arrest
regulation of methylation-dependent chromatin silencing
ubiquitin-dependent protein catabolic process
biological_process
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support