Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
UPF1 Monoclonal Antibody (11E7)
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 6
UPF1 Antibody (MA5-49176) in ICC/IF
Immunocytochemistry analysis of UPF1 in U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. Samples were then incubated in UPF1 Monoclonal antibody (Product # MA5-49176) using a dilution of 2 μg/mL. DyLight®594 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for t... View More
Product Details
MA5-49176
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Mouse
/ IgG2b
Class
Monoclonal
Type
Antibody
Clone
11E7
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578-614aa NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_3074834
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Immunogen sequence is identical to the related mouse and rat sequences.
Positive Control - WB: rat brain tissue, mouse brain tissue, human RAW2647 whole cell, human HepG2 whole cell, human Raji whole cell, human PC-3 whole cell, human Hela whole cell, human HEK293 whole cell. IHC: human mammary cancer tissue, mouse intestine tissue, mouse intestine tissue, rat intestine tissue. ICC/IF: U20S cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Upf1 was identified as an active component in nonsense-mediated decay (NMD), an mRNA surveillance mechanism in eukaryotic cells that degrades mRNAs containing premature termination codons. Upf1 was found to be an ATP-dependent RNA helicase in the cytoplasm and was later shown to be a component of cytoplasmic P-bodies. Upf1 phosphorylation mediates the repression of translation that accompanies NMD, allowing mRNA accessibility to the NMD machinery. Two other active components of NMD, Upf2 and Upf3, were also identified and described as having perinuclear and nucleocytoplasmic localization, respectively.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ATP-dependent helicase RENT1; delta helicase; FLJ43809; FLJ46894; hUpf1; mUpf1; Nonsense mRNA reducing factor 1; NORF1; Regulator of nonsense transcripts 1; Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog); smg-2 homolog, nonsense mediated mRNA decay factor; up-frameshift mutation 1 homolog; Up-frameshift suppressor 1 homolog; UPF1 regulator of nonsense transcripts homolog; UPF1 regulator of nonsense transcripts homolog (yeast); yeast Upf1p homolog
Gene Aliases: B430202H16Rik; HUPF1; KIAA0221; NORF1; PNORF-1; pNORF1; RENT1; smg-2; UPF1; Upflp
UniProt ID: (Human) Q92900, (Mouse) Q9EPU0
Entrez Gene ID: (Human) 5976, (Rat) 684558, (Mouse) 19704
nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
nuclear-transcribed mRNA catabolic process
DNA replication
DNA repair
regulation of translational termination
dosage compensation by inactivation of X chromosome
histone mRNA catabolic process
nuclear-transcribed mRNA catabolic process, endonucleolytic cleavage-dependent decay
telomere maintenance
mRNA export from nucleus
telomere maintenance via semi-conservative replication
positive regulation of mRNA catabolic process
3'-UTR-mediated mRNA destabilization
cellular response to lipopolysaccharide
cellular response to interleukin-1
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support