Invitrogen

WNT7A Polyclonal Antibody

2 Published Figures
1 Reference
View all (8) WNT7A antibodies

Promotion

View available promotion(s)

Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Product Details

PA5-80231

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
View 1 publication 1 publication

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Published species

Mouse

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2747345

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human hepatocellular carcinoma tumor tissue (HCCT), human hepatocellular carcinoma paracancerous tissue (HCCP)rat kidney tissue, rat liver tissue, mouse kidney tissue, mouse liver tissue. Flow: PC-3 cell.

Target Information

Wnt-7a belongs to the Wnt family of signaling proteins that play a key role in maintaining the integrity of embryonic and adult tissues. It is expressed in placenta, kidney, testis, uterus, fetal lung, and fetal and adult brain. Most Wnt proteins can signal though a mechanism called the canonical Wnt pathway, in which Wnt proteins bind to and activate seven-pass transmembrane receptors of the Frizzled family, ultimately leading to the disruption of ß-catenin degradation. Intracellular accumulation of ß-catenin increases translocation of the protein into the nucleus, where it binds to TCF/LEF transcription factors to induce the expression of numerous genes. Increased Wnt/ß-catenin signaling is associated with tumorigenesis in a diverse set of human cancers. However, Wnt-7a/Frizzled-9 signaling has been shown to act as a tumor suppressor in non-small cell lung cancers.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Bioinformatics

Protein Aliases: postaxial hemimelia; Protein Wnt-7a; proto-oncogene Wnt7a protein; wingless-related MMTV integration site 7A; wingless-type MMTV integration site 7A; wingless-type MMTV integration site family member 7A; wingless-type MMTV integration site family, member 7A

View more View less

Gene Aliases: AI849442; px; tw; Wnt-7a; WNT7A

View more View less

UniProt ID: (Human) O00755, (Mouse) P24383

View more View less

Entrez Gene ID: (Human) 7476, (Rat) 114850, (Mouse) 22421

View more View less

Function(s)
receptor binding frizzled binding cytokine activity protein binding receptor agonist activity
Process(es)
embryonic axis specification cartilage condensation angiogenesis chondrocyte differentiation neurotransmitter secretion axonogenesis synapse assembly sex differentiation asymmetric protein localization dorsal/ventral pattern formation positive regulation of endothelial cell migration skeletal muscle satellite cell activation skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration Wnt signaling pathway cerebellar granule cell differentiation cell proliferation in forebrain central nervous system vasculogenesis establishment of cell polarity regulation of axon diameter response to estradiol somatic stem cell population maintenance embryonic forelimb morphogenesis embryonic hindlimb morphogenesis non-canonical Wnt signaling pathway Wnt signaling pathway involved in wound healing, spreading of epidermal cells synaptic vesicle recycling embryonic digit morphogenesis negative regulation of apoptotic process response to estrogen cell fate commitment positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter positive regulation of JNK cascade somatic stem cell division stem cell development negative regulation of neurogenesis positive regulation of synapse assembly palate development positive regulation of epithelial cell proliferation involved in wound healing oviduct development canonical Wnt signaling pathway dendritic spine morphogenesis uterus morphogenesis lens fiber cell development cellular response to transforming growth factor beta stimulus positive regulation of canonical Wnt signaling pathway positive regulation of protein localization to synapse excitatory synapse assembly positive regulation of excitatory synapse assembly positive regulation of excitatory postsynaptic potential positive regulation of cell proliferation positive regulation of gene expression neuron differentiation embryonic limb morphogenesis forelimb morphogenesis hindlimb morphogenesis wound healing regulation of cell proliferation skin morphogenesis reproductive structure development skeletal system morphogenesis regulation of axonogenesis synapse organization cartilage development uterus development limb development signal transduction cell-cell signaling multicellular organism development organ morphogenesis positive regulation of receptor activity
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support