Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
YY1 Monoclonal Antibody (2C10F9)
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 7
YY1 Antibody (MA5-49173) in IHC (P)
Immunohistochemistry analysis of YY1 in paraffin-embedded section of human pancreatic ductal adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. Samples were incubated with YY1 Monoclonal antibody (Product # MA5-49173) using a dilution of 2 μg/mL overnight at 4°C. Peroxidase Conjugated G... View More
Product Details
MA5-49173
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Mouse
/ IgG2a
Class
Monoclonal
Type
Antibody
Clone
2C10F9
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human YY1 (206-241aa EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_3074831
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Immunogen sequence is identical to the related mouse sequence.
Positive Control - WB: human Caco-2 whole cell, human SW620 whole cell, human MDA-MB-453, human PC-3 whole cell, rat thymus tissue, mouse thymus tissue. IHC: human thyroid cancer tissue, human pancreatic ductal adenocarcinoma tissue, human laryngeal squamous cell carcinomas tissue, human renal clear cell carcinoma tissue. Flow: PC-3 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Delta transcription factor; INO80 complex subunit S; NF-E1; Transcriptional repressor protein YY1; UCR-motif DNA-binding protein; UCRBP transcription factor; Yin and yang 1; Yin and Yang 1 protein; Yin Yang 1; YY-1
Gene Aliases: AW488674; DELTA; INO80S; NF-E1; NMP-1; NMP1; UCRBP; YIN-YANG-1; YY1
UniProt ID: (Human) P25490, (Mouse) Q00899
Entrez Gene ID: (Human) 7528, (Rat) 24919, (Mouse) 22632
four-way junction DNA binding
transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
enhancer sequence-specific DNA binding
DNA binding
transcription factor activity, sequence-specific DNA binding
transcription coactivator activity
transcription corepressor activity
RNA binding
protein binding
zinc ion binding
transcription regulatory region DNA binding
SMAD binding
histone deacetylase binding
sequence-specific DNA binding
metal ion binding
nucleic acid binding
negative regulation of transcription from RNA polymerase II promoter
double-strand break repair via homologous recombination
regulation of transcription, DNA-templated
transcription from RNA polymerase II promoter
RNA localization
cellular response to DNA damage stimulus
spermatogenesis
anterior/posterior pattern specification
response to UV-C
positive regulation of gene expression
cellular response to UV
response to prostaglandin F
positive regulation of transcription from RNA polymerase II promoter
camera-type eye morphogenesis
chromosome organization
cellular response to interleukin-1
transcription, DNA-templated
regulation of transcription from RNA polymerase II promoter
negative regulation of gene expression
cell differentiation
DNA repair
DNA recombination
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support