Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
alpha Actinin 3 Polyclonal Antibody, DyLight™ 488
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 1
alpha Actinin 3 Antibody (PA5-78719) in Flow
Flow Cytometry of alpha Actinin 3 in HeLa cells (blue line), isotype control rabbit IgG (green line) and unlabeled (red line). Samples were blocked with 10% goat serum and then incubated with alpha Actinin 3 Polyclonal Antibody, DyLight™ 488 (Product # PA5-78719) at a dilution of 1 μg (per 1x10^6 cells) for 30 min at 20°C.
Product Details
PA5-78719
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K).
Conjugate
Excitation/Emission Max
492/519 nm
View spectra
Form
Liquid
Concentration
0.5 mg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 50% glycerol
Contains
0.02% sodium azide
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles, store in dark
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2745835
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.|Positive Control|Flow: A431 cell.
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.|Positive Control - Flow: A431 cell.
Target Information
Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
How to use the Panel Builder
Watch the video to learn how to use the Invitrogen Flow Cytometry Panel Builder to build your next flow cytometry panel in 5 easy steps.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Actinin alpha3; actinin, alpha 3; Actinin-alpha3; alpha-actinin skeletal muscle; Alpha-actinin skeletal muscle isoform 3; Alpha-actinin-3; alpha-Actinin3; alphaActinin-3; F-actin cross-linking protein
Gene Aliases: ACTN3
UniProt ID: (Human) Q08043
Entrez Gene ID: (Human) 89
regulation of the force of skeletal muscle contraction
skeletal muscle atrophy
transition between fast and slow fiber
response to denervation involved in regulation of muscle adaptation
muscle filament sliding
regulation of apoptotic process
negative regulation of glycolytic process
focal adhesion assembly
positive regulation of skeletal muscle tissue growth
negative regulation of calcineurin-NFAT signaling cascade
negative regulation of oxidative phosphorylation
regulation of aerobic respiration
positive regulation of glucose catabolic process to lactate via pyruvate
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support