Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human ATG5 (aa 126-265) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-89637
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
MSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFL
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
ATG5 (Autophagy Related 5) is an important element for autophagy and may play an important role in the apoptotic process. ATG5 is also involved in other cellular processes that include mitochondrial quality control after oxidative damage, negative regulation of the innate anti-viral immune response, lymphocyte development and proliferation, MHC II antigen presentation, and adipocyte differentiation. Following conjugation to ATG12, the conjugate participates in the formation of autophagosome. ATG5 contributes to autophagic cell death by interacting with Fas-associated protein with death domain (FADD). The ATG5-ATG12 conjugate forms a cup-shaped isolation membrane that then detaches from the membrane immediately before or after autophagosome formation is completed. APG5 may play a role in the apoptotic process, possibly within the modified cytoskeleton. Further, APG5 expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity. The APG5-APG12 conjugate also associates with innate immune response proteins such as RIG-I and VISA (also known as IPS-1), inhibiting type I interferon production and permitting viral replication in host cells. Diseases associated with ATG5 dysfunction include spinocerebellar ataxia.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: APG 5; APG5 autophagy 5 like (APG5L); APG5-like; Apoptosis-specific protein; Apoptosis-specific protein (ASP); ATG5 autophagy related 5 homolog; Autophagy protein 5
Gene Aliases: APG5; APG5-LIKE; APG5L; ASP; ATG5; hAPG5
UniProt ID: (Human) Q9H1Y0
Entrez Gene ID: (Human) 9474
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support