Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human Aurora B (aa 10-75) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-105937
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The Aurora kinases associate with microtubules during chromosome movement and segregation. AURKB (Aurora B) localizes to microtubules near kinetochores, specifically to the specialized microtubules called K-fibers. This complex functions in chromosome alignment and separation, histone modification, and cytokinesis. CPC also includes three non-enzymatic subunits known as the inner centromere protein (INCENP), survivin, and borealin, which determine the activity, localization, stability, and possibly even the substrate specificity of AurB. Two CPCs exist during mitosis: one containing all four members and another consisting of INCENP and AurB. Quaternary CPC functions during chromosome alignment and cytokinesis, whereas the INCENP-AurB complex may be responsible for modifying histone H3. AurB is overexpressed in a number of tumours, including primary breast and colon tumour samples. Its expression in tumours seems to be linked with Aurora-A kinase, suggesting a feedback mechanism between the two proteins.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: AIM-1; ARK-2; Aurora 1; Aurora kinase B; aurora kinase B-Sv1; aurora kinase B-Sv2; Aurora- and IPL1-like midbody-associated protein 1; aurora-1; aurora-B; aurora-related kinase 2; Aurora/IPL1-related kinase 2; protein phosphatase 1, regulatory subunit 48; serine/threonine kinase 12; Serine/threonine-protein kinase 12; Serine/threonine-protein kinase 5; Serine/threonine-protein kinase aurora-B; STK-1
Gene Aliases: AIK2; AIM-1; AIM1; AIRK2; ARK2; AurB; AURKB; aurkb-sv1; aurkb-sv2; IPL1; PPP1R48; STK1; STK12; STK5
UniProt ID: (Human) Q96GD4
Entrez Gene ID: (Human) 9212
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support