Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human BST-1 (aa 37-110) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-101192
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
EGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWE
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CD157, also known as Bone Marrow Stromal Cell Antigen 1 (BST1), is a pleiotropic ectoenzyme and glycosylphosphatidylinositol-anchored molecule that functions both as an enzyme and a receptor. Similar to CD38, CD157 is involved in the metabolism of NAD+, which may play a role in regulating intracellular Ca2+ levels. As an enzyme, CD157 is also referred to as ADP-ribosyl cyclase 2 and DAMP-1, and it facilitates pre-B cell growth. As a receptor, CD157 is thought to initiate a signal transduction cascade upon binding to its putative ligand, leading to the phosphorylation of cytoplasmic proteins, including focal adhesion kinase (FAK). While the mechanism and functional significance of CD157-initiated signal transduction are not fully characterized, its role in cellular signaling is evident. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis, suggesting a link to polyclonal B cell abnormalities observed in the disease. This overexpression in the stromal cell population may contribute to the pathophysiology of rheumatoid arthritis, highlighting the importance of CD157/BST1 in both normal immune function and disease states.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ADP-ribosyl cyclase 2; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2; bone marrow stromal antigen 1; Bone marrow stromal cell antigen 1; BST-1; cADPR hydrolase 2; CD157; CD157 antigen; Cyclic ADP-ribose hydrolase 2; NAD(+) nucleosidase; NAD+ nucleosidase
Gene Aliases: BST1; CD157
UniProt ID: (Human) Q10588
Entrez Gene ID: (Human) 683
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support