Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human CD61 (aa 385-490) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-88614
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
VRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGP
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CD61, also known as GPIIIa or ITGB3, is a 105 kDa glycoprotein expressed on activated T cells, granulocytes, megakaryocytes, platelets, and their precursors. It plays a crucial role in platelet aggregation and functions as a receptor for fibrinogen, fibronectin, von Willebrand factor, vitronectin, and thrombospondin. CD61 forms heterodimeric complexes by associating non-covalently with integrin alpha subunits: alphaV (CD51) to create the Vitronectin Receptor and alphaIIb (CD41) to form gpIIb/IIIa. These complexes are responsible for adhesion to extracellular matrix components, facilitating cell adhesion and cell-surface mediated signaling. CD61 is expressed on platelets and megakaryocytes in association with CD41, and on endothelial cells, monocytes, and osteoclasts in association with CD51. The protein product of CD61 is composed of an alpha chain and a beta chain, which can combine with multiple partners to form different integrins. Its involvement in cell adhesion and signaling underscores its importance in normal physiological processes. Dysfunction of CD61 is associated with diseases such as Glanzmann Thrombasthenia and Platelet type-16 Bleeding Disorder, highlighting its critical role in hemostasis and platelet function.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: antigen CD61; CD61; GPIIIa; integrin beta 3; Integrin beta-3; integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61); Platelet membrane glycoprotein IIIa
Gene Aliases: BDPLT16; BDPLT2; CD61; GP3A; GPIIIa; GT; ITGB3
UniProt ID: (Human) P05106
Entrez Gene ID: (Human) 3690
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support