Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human Kir4.1 (KCNJ10) (aa 310-379) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-108298
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
EFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85057. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The KIR (for inwardly rectifying potassium channel) family of potassium channels possess a greater tendency to allow potassium to flow into the cell rather than out of it. KIR4.1, also known as Kir1.2, is highly expressed in brain including glial cells, astrocytes and cortical neurons. KIR4.1 is also expressed in myelin-synthesizing oligodendrocytes and is crucial to myelination in the developing nervous system. The gene encoding human KIR4.1 maps to chromosome 1. KIR4.2, also known as Kir1.3, is expressed in kidney, lung, heart, thymus and thyroid during development. The gene encoding human KIR4.2 maps to chromosome 21 in the Down syndrome chromosome region 1, and KIR4.2 may play a role in the pathogenesis of Downs syndrome. KIR5.1 forms functional channels only by coexpression with either KIR4.1 or KIR4.2 in the kidney and pancreas.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ATP-dependent inwardly rectifying potassium channel Kir4.1; ATP-sensitive inward rectifier potassium channel 10; BIRK10; glial ATP-dependent inwardly rectifying potassium channel KIR4.1; Inward rectifier K(+) channel Kir1.2; inward rectifier K+ channel KIR1.2; KCNJ13 PEN; Potassium channel, inwardly rectifying subfamily J member 10; potassium channel, inwardly rectifying subfamily J, member 10; potassium inwardly-rectifying channel, subfamily J, member 10
Gene Aliases: BIRK-10; KCNJ10; KCNJ13-PEN; KIR1.2; KIR4.1; SESAME
UniProt ID: (Human) P78508
Entrez Gene ID: (Human) 3766
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support