Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human MASP2 (aa 428-575) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-102355
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
PVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGL
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56111. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Mannose (or mannan)-binding lectin (MBL), also known as serum mannosebinding protein (MBP), initiates the lectin branch of the innate immune response by binding to the surface of potentially pathogenic microorganisms and initiating complement fixation through an N-terminal collagen-like domain. MBL is a key component in immune response in that it can directly trigger neutralization of invading microorganisms by an Ab-independent mechanism. Mutations of human MBL are associated with immunodeficiency resulting from a reduction in the ability of the mutant MBL to initiate complement fixation. In human, three types of MBL-associated serine proteases, MASP-1, MASP-2 and MASP-3, and a truncated form of MASP-2 (small MBL-associated protein; sMAP or MAp19) complex with MBL to activate the lectin pathway of the complement system. Activated MASPs subsequently cleave and activate downstream components of the complement pathway. MASP-3 is an alternatively spliced product from the MASP-1 gene and may function to inhibit MASP-2 by competing for MBL binding and inhibiting the activation of MBLassociated MASP-2.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: mannan-binding; mannan-binding lectin serine peptidase 1 pseudogene 1; mannan-binding lectin serine protease 1 pseudogene 1; Mannan-binding lectin serine protease 2; Mannose-binding protein-associated serine protease 2; MASP-2; MBL-associated plasma protein of 19 kD; MBL-associated serine protease 2; small MBL-associated protein
Gene Aliases: MAP19; MASP-2; MASP1P1; MASP2; sMAP
UniProt ID: (Human) O00187
Entrez Gene ID: (Human) 10747
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support