Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human Placental Alkaline Phosphatase (aa 189-218) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-98831
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
NWYSDADVPASARQEGCQDIATQLISNMDI
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83438. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Placental Alkaline Phosphatase plays an important role in the regulation of specific inflammatory disease processes. There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney for this form of alkaline phosphatase have been well characterized. Placental Alkaline Phosphatase reacts with a membrane-bound isoenzyme (Regan and Nagao type) of Placental Alkaline Phosphatase (PLAP) occurring in the placenta during the 3rd trimester of gestation. Placental Alkaline Phosphatase is useful in the identification of testicular germ cell tumors. Unlike germ cell tumors, PLAP-positive somatic cell tumors uniformly express epithelial membrane antigen (EMA). A proposed function of Placental Alkaline Phosphatase is matrix mineralization; however, mice that lack a functional form of this enzyme show normal skeletal development. Placental Alkaline Phosphatase has been linked directly to hypophosphatasia, a disorder that is characterized by hypercalcemia and includes skeletal defects. The character of hypophosphatasia can vary, however, depending on the specific mutation since this determines age of onset and severity of symptoms.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Alkaline phosphatase placental type; Alkaline phosphatase Regan isozyme; Alkaline phosphatase, placental type; alkaline phosphomonoesterase; Alp1; AP-TNAP; DOA1; FLJ11281; FLJ40094; FLJ61142; FLJ93059; Germ-cell alkaline phosphatase; glycerophosphatase; HOPS; MGC161443; MGC167935; nagao Isozyme; P PLAP; PLA2P; PLAA; Placental alkaline phosphatase 1; placental heat-stable alkaline phosphatase; PLAP-1; PLAP1; Regan isozyme; TNAP; TNSALP
Gene Aliases: ALP; ALPP; PALP; PLAP; PLAP-1
UniProt ID: (Human) P05187
Entrez Gene ID: (Human) 250
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support