Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human SALL1 (aa 562-636) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-101166
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
TLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPESATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPT
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62057. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Sall1, which encodes a zinc finger protein, functions as a transcriptional repressor and interacts physically with histone deacetylase and other components of the chromatin remodeling NuRD complex. It is unknown whether the transcriptional repression is solely dependent on histone deacetylase activity. Gene expression profiling has identified Sall1 as a microglial signature gene. Microglia are the resident macrophages of the central nervous system (CNS). Sall1 is also expressed in abundance in the mesenchyme-derived structure from condensed mesenchyme, S-comma-shaped bodies, to renal tubules and podocytes. Sall1 has been identified as a key transcription factor in self-renewal renal progenitor cells. Sall1 is required to maintain the stemness of nephron progenitor cells by restraining their differentiation into renal vesicles. Defects in SALL1 are the cause of Townes-Brocks syndrome as well as bronchio-oto-renal syndrome. Heterozygous mutations of human SALL1 leading to Townes-Brocks syndrome features dysplastic ears, preaxial polydactyly, imperforate anus, and less commonly, kidney and heart anomalies (Kohlhase et al. 1998). Two transcript variants encoding different isoforms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: epididymis secretory protein Li 89; HSal1; Sal-like protein 1; Spalt-like transcription factor 1; Zinc finger protein 794; Zinc finger protein SALL1; Zinc finger protein Spalt-1
Gene Aliases: HEL-S-89; HSAL1; Sal-1; SAL1; SALL1; TBS; ZNF794
UniProt ID: (Human) Q9NSC2
Entrez Gene ID: (Human) 6299
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support