Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human SLC16A2 (aa 499-539) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-107895
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67259. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Monocarboxylates, such as lactate and pyruvate, play an integral role in cellular metabolism. Lactic acid is produced in large quantities as a result of glycolysis, which provides the majority of ATP to cells under normal physiological conditions. However, accumulation of lactic acid leads to a decrease in intracellular pH and cessation of glycolysis. In order for glycolysis to continue at a high rate, lactic acid must be transported out of the cell. This transport process is carried out by a family of monocarboxylate transporters (MCTs), which function as proton symports and are stereoselective for L-lactate. The MCT family consists of at least eight members, MCT 1-8, which contain between 10-12 transmembrane-helical (TM) domains, with the amino and carboxy termini located in the cytoplasm. Defects in the gene encoding for MCT8, SLC16A2, can cause monocarboxylate transporter 8 deficiency (MCT8 deficiency), a defect in cellular hormone transport causing a severe form of X-linked psychomotor retardation and abnormal thyroid levels.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: MCT 7; MCT 8; monocarboxylate transporter; Monocarboxylate transporter 7; Monocarboxylate transporter 8; Solute carrier family 16 member 2; solute carrier family 16, member 2 (thyroid hormone transporter); X-linked PEST-containing transporter
Gene Aliases: AHDS; DXS128; DXS128E; MCT 7; MCT 8; MCT7; MCT8; MRX22; SLC16A2; XPCT
UniProt ID: (Human) P36021
Entrez Gene ID: (Human) 6567
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support