Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human uPAR (aa 51-156) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-102358
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGE
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The urokinase-type plasminogen activator receptor is a key molecule in the regulation of cell-surface plasminogen activation and plays an important role in many normal as well as pathologic processes. The human PLAUR cDNA encodes 335 amino acids including a predicted signal peptide of 22 residues and a hydrophobic C-terminal portion. It produces a highly glycosylated protein of about 50 kD in monocytes where it is anchored to the plasma membrane by glycosyl-phosphatidylinositol linkage. PLAUR, also known as UPAR, is directly associated with the carbohydrate-binding domain of SELL in the membrane of neutrophils, an association analogous to that between PLAUR and beta-2 integrins. PLAUR-mediated calcium mobilization is SELL dependent. UPAR mRNA levels correlate with the invasive potential of endometrial carcinomas and show a 33-fold increase in UPAR mRNA levels in advanced clinical stage endometrial tumors compared with normal endometrial tissue. Furthermore, the increase in UPAR mRNA levels correlated linearly with the progression of disease stage. UPAR protein expressioin correlated positively with rate of recurrence and mortality in patients with endometrial cancer. UPAR appears to be a useful prognostic marker for advanced endometrial cancer.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CD87; Monocyte activation antigen Mo3; sCD87; soluble CD87; U-PAR; u-plasminogen activator receptor form 2; Urokinase plasminogen activator surface receptor; urokinase-type plasminogen activator (uPA) receptor
Gene Aliases: CD87; MO3; PLAUR; U-PAR; UPAR; URKR
UniProt ID: (Human) Q03405
Entrez Gene ID: (Human) 5329
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support