Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • SMAD1/SMAD5 Antibodies

          Invitrogen

          SMAD1/SMAD5 Polyclonal Antibody

          1 Published Figure
          3 References
          View all (5) SMAD1/SMAD5 antibodies

          Promotion

          View available promotion(s)

          Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite SMAD1/SMAD5 Polyclonal Antibody

          • Antibody Testing Data (1)
          • Published Figures (1)
          SMAD1/SMAD5 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          SMAD1/SMAD5 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          SMAD1/SMAD5 Antibody (PA5-80036) in WB

          Western blot analysis of SMAD1/SMAD5 in Lane 1: rat kidney tissue lysate, Lane 2: rat testis tissue lysate, Lane 3: mouse brain tissue lysate, Lane 4: mouse kidney tissue lysate, Lane 5: mouse testis tissue lysate, Lane 6: human HeLa cell lysate, Lane 7: human A375 cell lysate, Lane 8: human HepG2 cell lysate using 50 µg (reducing conditions) per well. Electrophoresis was performed on 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours and protein was transferred to a nitrocellulose membrane at 150mA for 50-90 minu... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          SMAD1/SMAD5 Antibody in Western Blot (WB)
          SMAD1/SMAD5 Antibody in Western Blot (WB)

          Product Details

          PA5-80036

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          View 3 publications 3 publications
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Human, Mammal, Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of human SMAD1/SMAD5 (KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2747151

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat kidney tissue, rat testis tissue, mouse brain tissue, mouse kidney tissue, mouse testis tissue, human Hela cell, human A375 cell, human HepG2 cell.

          Target Information

          The Smad family of proteins are functioning in the transmission of extracellular signals in the TGF-beta signaling pathway. Binding of a TGF-beta superfamily ligands to extracellular receptors triggers phosphorylation of Smad2 at a Serine-Serine-Methionine-Serine (SSMS) motif at its C-terminus. Phosphorylated Smad2 is then able to form a complex with Smad4. These complexes accumulate in the cell nucleus, where they are directly participating in the regulation of gene expression. In mammals, eight Smad proteins have been identified to date. The Smad family of proteins can be divided into three functional groups: the receptor-activated Smads (R-Smads), common mediator Smads (Co-Smads), and the inhibitory Smads (I-Smads). The R-Smads are directly phosphorylated by the activated type I receptors on their C-terminal Ser-Ser-X-Ser (SSXS) motif and include Smad1, Smad2, Smad3, Smad5, and Smad8. Smad2 and Smad3 are phosphorylated in response to TGF-beta and activin, whereas Smad1, Smad5, and Smad8 are phosphorylated in response to BMP (Bone Morphogenetic Protein). This C-terminal phosphorylation allows R-Smad binding to Co-Smad, Smad4, and translocation to the nucleus where they regulate TGF-beta target genes. Smad6 and Smad7 belong to the I-Smad which bind to the type I receptor or Smad4 and block their interaction with R-Smads.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: BSP-1; Dwarfin-A; Dwarfin-C; Dwf-A; Dwf-C; hSMAD1; hSmad5; JV4-1; JV5-1; MAD (mothers against decapentaplegic, Drosophila) homolog 1; MAD homolog 1; MAD homolog 5; MAD homolog1 (mothers against decapentaplegic, Drosophila); MAD, mothers against decapentaplegic homolog 1; MAD, mothers against decapentaplegic homolog 5; Mad-related protein 1; mMad1; Mothers against decapentaplegic homolog 1; Mothers against decapentaplegic homolog 5; mothers against decapentaplegic, drosophila, homolog of, 5; mothers against DPP homolog 1; mothers against DPP homolog 5; Mothers-against-DPP-related 1; mSmad5; OTTHUMP00000223331; SMA- and MAD-related protein 5; SMAD; SMAD 1; SMAD 5; SMAD family member 1; SMAD family member 5; SMAD, mothers against DPP homolog 1; SMAD, mothers against DPP homolog 5; TGF-beta signaling protein 1; transforming growth factor-beta signaling protein 1; Transforming growth factor-beta-signaling protein 1

          View more View less

          Gene Aliases: 1110051M15Rik; AI451355; AI528653; BSP-1; BSP1; Dwf-C; DWFC; JV4-1; JV41; JV5-1; Mad1; MADH1; MADH5; MADR1; Mlp1; Msmad5; MusMLP; SMAD1; SMAD5

          View more View less

          UniProt ID: (Human) Q15797, (Human) Q99717, (Mouse) P70340, (Rat) P97588, (Mouse) P97454, (Rat) Q9R1V3

          View more View less

          Entrez Gene ID: (Human) 4086, (Human) 4090, (Mouse) 17125, (Rat) 25671, (Mouse) 17129, (Rat) 59328

          View more View less

          Function(s)
          RNA polymerase II core promoter proximal region sequence-specific DNA binding RNA polymerase II core promoter sequence-specific DNA binding transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding transcription factor activity, sequence-specific DNA binding receptor signaling protein activity protein binding protein kinase binding transforming growth factor beta receptor, pathway-specific cytoplasmic mediator activity identical protein binding protein homodimerization activity metal ion binding protein heterodimerization activity co-SMAD binding I-SMAD binding ubiquitin protein ligase binding DNA binding
          Process(es)
          ureteric bud development Mullerian duct regression osteoblast fate commitment transcription, DNA-templated protein phosphorylation signal transduction transforming growth factor beta receptor signaling pathway germ cell development embryonic pattern specification erythrocyte differentiation BMP signaling pathway positive regulation of osteoblast differentiation positive regulation of transcription, DNA-templated cartilage development cardiac muscle contraction bone development SMAD protein signal transduction cellular response to organic cyclic compound positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus angiogenesis regulation of transcription, DNA-templated multicellular organism development cell differentiation positive regulation of transcription from RNA polymerase II promoter cellular response to BMP stimulus MAPK cascade mesodermal cell fate commitment transcription from RNA polymerase II promoter inflammatory response SMAD protein complex assembly gamete generation negative regulation of cell proliferation positive regulation of gene expression midbrain development hindbrain development primary miRNA processing homeostatic process cardiac muscle cell proliferation positive regulation of cartilage development regulation of transcription from RNA polymerase II promoter response to drug positive regulation of cell differentiation kidney development response to organonitrogen compound negative regulation of muscle cell apoptotic process wound healing positive regulation of dendrite morphogenesis ossification regulation of ossification
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-67c77f6dc7-n6nf2:80/100.66.135.186:80.
          git-commit: 545e792480003146e539d624bd2a21b51d198228
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.31.0-2025.06.23-1.0