Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human CD73 (aa 119-232) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-90963
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82585. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CD73, also known as Ecto-5-prime-nucleotidase or 5-prime-ribonucleotide phosphohydrolase, is an enzyme that catalyzes the conversion of purine 5-prime mononucleotides to nucleosides at neutral pH, with AMP as its preferred substrate. It is composed of a dimer of two identical 70 kDa subunits, externally bound to the plasma membrane via a glycosyl phosphatidyl inositol linkage. CD73 serves as a marker of lymphocyte differentiation and is expressed on a subset of lymphocytes, increasing during lymphocyte maturation. It is found on memory CD4 T cells, which resemble uncommitted primed precursor helper cells (Thpp) capable of differentiating into Th1 or Th2 cells, and is also present on regulatory T cells. CD73 deficiency is associated with various immunodeficiency diseases. Other forms of 5-prime nucleotidase exist in the cytoplasm and lysosomes, distinguishable from CD73 by their substrate affinities, requirement for divalent magnesium ions, activation by ATP, and inhibition by inorganic phosphate. The CD73 gene is localized to chromosome 6q14-q21, and defects in this gene can lead to conditions such as calcification of joints and arteries, and intestinal tuberculosis. Additionally, two transcript variants encoding different isoforms of CD73 have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 5'-deoxynucleotidase; 5'-NT; 5'-nucleotidase; 5'-nucleotidase, ecto (CD73); CD73; Ecto-5'-nucleotidase; IMP-specific 5'-nucleotidase; Purine 5-Prime-Nucleotidase; Thymidylate 5'-phosphatase
Gene Aliases: CALJA; CD73; E5NT; eN; eNT; NT; NT5; NT5E; NTE
UniProt ID: (Human) P21589
Entrez Gene ID: (Human) 4907
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support